SPOP (NM_001007229) Human Mass Spec Standard

SKU
PH301551
SPOP MS Standard C13 and N15-labeled recombinant protein (NP_001007230)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201551]
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC201551 protein sequence
Red=Cloning site Green=Tags(s)

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA
EAYRSLASAQCPFLGPPRKRLKQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007230
RefSeq Size 2982
RefSeq ORF 1122
Synonyms BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2
Locus ID 8405
UniProt ID O43791
Cytogenetics 17q21.33
Summary This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SPOP (NM_001007229) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401186 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423451 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423453 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423454 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425209 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401186 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 100 ug
$436.00
LY423451 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 100 ug
$436.00
LY423453 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 100 ug
$436.00
LY423454 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 6 100 ug
$436.00
LY425209 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 100 ug
$436.00
TP301551 Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.