OriGene Logo

SPOP Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342120
Rabbit Polyclonal Anti-SPOP Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY401186 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 100 ug
$436.00
TP301551 Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6, 20 µg
20 ug
$737.00

View other "SPOP or NM_001007226" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SPOP antibody: synthetic peptide directed towards the C terminal of human SPOP. Synthetic peptide located within the following region: YHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name speckle type BTB/POZ protein
Database Link
Background SPOP may modulateThe transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse,The protein binds toThe putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes.The BTB/POZ domain ofThis protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes.This gene encodes a protein that may modulateThe transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse,The encoded protein binds toThe putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes.The BTB/POZ domain ofThis protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing ofThis gene results in multiple transcript variants encodingThe same protein.
Synonyms BTBD32; TEF2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.