ELOB (NM_007108) Human Recombinant Protein
SKU
TP301393
Recombinant protein of human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201393 protein sequence
Red=Cloning site Green=Tags(s) MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQ APATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009039 |
Locus ID | 6923 |
UniProt ID | Q15370 |
Cytogenetics | 16p13.3 |
RefSeq Size | 1009 |
RefSeq ORF | 354 |
Synonyms | SIII; TCEB2 |
Summary | This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, Aug 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301393 | TCEB2 MS Standard C13 and N15-labeled recombinant protein (NP_009039) | 10 ug |
$3,255.00
|
|
PH319239 | TCEB2 MS Standard C13 and N15-labeled recombinant protein (NP_996896) | 10 ug |
$3,255.00
|
|
LC404134 | TCEB2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416188 | TCEB2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404134 | Transient overexpression lysate of transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 2 | 100 ug |
$436.00
|
|
LY416188 | Transient overexpression lysate of transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1 | 100 ug |
$436.00
|
|
TP319239 | Recombinant protein of human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.