ELOB Rabbit Polyclonal Antibody

SKU TA329241

Rabbit Polyclonal anti-TCEB2 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEB2 antibody: synthetic peptide directed towards the middle region of human TCEB2. Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 13 kDa
• Gene Name: transcription elongation factor B subunit 2
• Database Link:
  NP_009039
  Q15370
• Background: TCEB2 is the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Synonyms: ELOB; SIII
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis