ELOB (NM_207013) Human Mass Spec Standard

SKU PH319239

TCEB2 MS Standard C13 and N15-labeled recombinant protein (NP_996896)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC219239]
• Predicted MW: 17.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC219239 representing NM_207013; Red=Cloning site Green=Tags(s); ; MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQ; APATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVHLHVHSQTMAKNRNTSWSQCPGL; TACSTREPQDGPTQVHPRWGL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_996896
• RefSeq Size: 609
• RefSeq ORF: 483
• Synonyms: SIII; TCEB2
• Locus ID: 6923
• UniProt ID: Q15370
• Cytogenetics: 16p13.3
• Summary: This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, Aug 2008]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis