IDH2 (NM_002168) Human Recombinant Protein

SKU
TP301152
Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201152 protein sequence
Red=Cloning site Green=Tags(s)

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002159
Locus ID 3418
UniProt ID P48735
Cytogenetics 15q26.1
RefSeq Size 1818
RefSeq ORF 1356
Synonyms D2HGA2; ICD-M; IDH; IDHM; IDP; IDPM; mNADP-IDH
Summary Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Protein Pathways Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:IDH2 (NM_002168) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301152 IDH2 MS Standard C13 and N15-labeled recombinant protein (NP_002159) 10 ug
$3,255.00
LC400787 IDH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400787 Transient overexpression lysate of isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP700057 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172K), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP700058 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172M), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP700059 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172G), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP710214 Purified recombinant protein of mutant(R172G) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710215 Purified recombinant protein of mutant(R172M) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710216 Purified recombinant protein of mutant(R172K) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710217 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, full length, with C-terminal HIS tag, expressed in sf9, 20ug 20 ug
$515.00
TP710228 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172G) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710229 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172M) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710230 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172K) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.