IDH2 (NM_002168) Human Mass Spec Standard

SKU
PH301152
IDH2 MS Standard C13 and N15-labeled recombinant protein (NP_002159)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201152]
Predicted MW 50.9 kDa
Protein Sequence
Protein Sequence
>RC201152 protein sequence
Red=Cloning site Green=Tags(s)

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002159
RefSeq Size 1818
RefSeq ORF 1356
Synonyms D2HGA2; ICD-M; IDH; IDHM; IDP; IDPM; mNADP-IDH
Locus ID 3418
UniProt ID P48735
Cytogenetics 15q26.1
Summary Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Protein Pathways Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:IDH2 (NM_002168) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400787 IDH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400787 Transient overexpression lysate of isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP301152 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00
TP700057 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172K), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP700058 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172M), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP700059 Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172G), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP710214 Purified recombinant protein of mutant(R172G) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710215 Purified recombinant protein of mutant(R172M) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710216 Purified recombinant protein of mutant(R172K) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710217 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, full length, with C-terminal HIS tag, expressed in sf9, 20ug 20 ug
$515.00
TP710228 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172G) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710229 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172M) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg 20 ug
$515.00
TP710230 Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172K) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.