IDH2 (NM_002168) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201152] |
Predicted MW | 50.9 kDa |
Protein Sequence |
Protein Sequence
>RC201152 protein sequence
Red=Cloning site Green=Tags(s) MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002159 |
RefSeq Size | 1818 |
RefSeq ORF | 1356 |
Synonyms | D2HGA2; ICD-M; IDH; IDHM; IDP; IDPM; mNADP-IDH |
Locus ID | 3418 |
UniProt ID | P48735 |
Cytogenetics | 15q26.1 |
Summary | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
Protein Pathways | Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400787 | IDH2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400787 | Transient overexpression lysate of isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein | 100 ug |
$436.00
|
|
TP301152 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, 20 µg | 20 ug |
$737.00
|
|
TP700057 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172K), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug | 20 ug |
$867.00
|
|
TP700058 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172M), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug | 20 ug |
$867.00
|
|
TP700059 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172G), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug | 20 ug |
$867.00
|
|
TP710214 | Purified recombinant protein of mutant(R172G) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg | 20 ug |
$515.00
|
|
TP710215 | Purified recombinant protein of mutant(R172M) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg | 20 ug |
$515.00
|
|
TP710216 | Purified recombinant protein of mutant(R172K) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg | 20 ug |
$515.00
|
|
TP710217 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, full length, with C-terminal HIS tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP710228 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172G) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg | 20 ug |
$515.00
|
|
TP710229 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172M) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg | 20 ug |
$515.00
|
|
TP710230 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172K) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.