Myelin Basic Protein (MBP) (NM_001025090) Human Recombinant Protein

SKU
TP300710
Recombinant protein of human myelin basic protein (MBP), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200710 protein sequence
Red=Cloning site Green=Tags(s)

MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHY
GSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHK
GFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020261
Locus ID 4155
UniProt ID P02686
Cytogenetics 18q23
RefSeq Size 2222
RefSeq ORF 513
Summary The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myelin Basic Protein (MBP) (NM_001025090) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300710 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020261) 10 ug
$3,255.00
PH309071 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020271) 10 ug
$3,255.00
PH310291 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020263) 10 ug
$3,255.00
PH315746 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020252) 10 ug
$3,255.00
PH321469 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020272) 10 ug
$3,255.00
LC422581 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422582 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422584 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422587 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422588 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425478 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422581 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 100 ug
$436.00
LY422582 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 3 100 ug
$436.00
LY422584 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 4 100 ug
$436.00
LY422587 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 8 100 ug
$436.00
LY422588 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 7 100 ug
$436.00
LY425478 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 100 ug
$436.00
TP309071 Recombinant protein of human myelin basic protein (MBP), transcript variant 8, 20 µg 20 ug
$867.00
TP310291 Recombinant protein of human myelin basic protein (MBP), transcript variant 4, 20 µg 20 ug
$867.00
TP315746 Recombinant protein of human myelin basic protein (MBP), transcript variant 1, 20 µg 20 ug
$867.00
TP321469 Purified recombinant protein of Homo sapiens myelin basic protein (MBP), transcript variant 7, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.