Myelin Basic Protein (MBP) (NM_001025100) Human Mass Spec Standard

SKU
PH309071
MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020271)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209071]
Predicted MW 21.5 kDa
Protein Sequence
Protein Sequence
>RC209071 protein sequence
Red=Cloning site Green=Tags(s)

MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRT
ADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRP
SQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVSSEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020271
RefSeq Size 4889
RefSeq ORF 591
Locus ID 4155
UniProt ID P02686
Cytogenetics 18q23
Summary The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myelin Basic Protein (MBP) (NM_001025100) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300710 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020261) 10 ug
$3,255.00
PH310291 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020263) 10 ug
$3,255.00
PH315746 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020252) 10 ug
$3,255.00
PH321469 MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020272) 10 ug
$3,255.00
LC422581 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422582 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422584 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422587 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422588 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425478 MBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422581 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 100 ug
$436.00
LY422582 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 3 100 ug
$436.00
LY422584 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 4 100 ug
$436.00
LY422587 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 8 100 ug
$436.00
LY422588 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 7 100 ug
$436.00
LY425478 Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 100 ug
$436.00
TP300710 Recombinant protein of human myelin basic protein (MBP), transcript variant 3, 20 µg 20 ug
$867.00
TP309071 Recombinant protein of human myelin basic protein (MBP), transcript variant 8, 20 µg 20 ug
$867.00
TP310291 Recombinant protein of human myelin basic protein (MBP), transcript variant 4, 20 µg 20 ug
$867.00
TP315746 Recombinant protein of human myelin basic protein (MBP), transcript variant 1, 20 µg 20 ug
$867.00
TP321469 Purified recombinant protein of Homo sapiens myelin basic protein (MBP), transcript variant 7, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.