Myelin Basic Protein (MBP) (NM_001025101) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221469] |
Predicted MW | 32.9 kDa |
Protein Sequence |
Protein Sequence
>RC221469 representing NM_001025101
Red=Cloning site Green=Tags(s) MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRT ADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRP SQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKS HGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDA QGTLSKIFKLGGRDSRSGSPMARR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001020272 |
RefSeq Size | 2794 |
RefSeq ORF | 912 |
Locus ID | 4155 |
UniProt ID | P02686 |
Cytogenetics | 18q23 |
Summary | The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300710 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020261) | 10 ug |
$3,255.00
|
|
PH309071 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020271) | 10 ug |
$3,255.00
|
|
PH310291 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020263) | 10 ug |
$3,255.00
|
|
PH315746 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020252) | 10 ug |
$3,255.00
|
|
LC422581 | MBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422582 | MBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422584 | MBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422587 | MBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422588 | MBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425478 | MBP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY422581 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 | 100 ug |
$436.00
|
|
LY422582 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 3 | 100 ug |
$436.00
|
|
LY422584 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 4 | 100 ug |
$436.00
|
|
LY422587 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 8 | 100 ug |
$436.00
|
|
LY422588 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 7 | 100 ug |
$436.00
|
|
LY425478 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 | 100 ug |
$436.00
|
|
TP300710 | Recombinant protein of human myelin basic protein (MBP), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP309071 | Recombinant protein of human myelin basic protein (MBP), transcript variant 8, 20 µg | 20 ug |
$867.00
|
|
TP310291 | Recombinant protein of human myelin basic protein (MBP), transcript variant 4, 20 µg | 20 ug |
$867.00
|
|
TP315746 | Recombinant protein of human myelin basic protein (MBP), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP321469 | Purified recombinant protein of Homo sapiens myelin basic protein (MBP), transcript variant 7, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.