OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HNRNPD (NM_002138) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300660
Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA377164 HNRNPD Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HNRNPD or NM_002138"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200660 protein sequence
Red=Cloning site Green=Tags(s)

MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDA
SKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGF
GFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVES
IELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRAR
GRGGDQQSGYGKVSRRGGHQNSYKPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002129
Locus ID 3184
UniProt ID Q14103
Cytogenetics 4q21.22
RefSeq Size 2110
RefSeq ORF 918
Synonyms AUF1; AUF1A; hnRNPD0; HNRPD; P37
Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HNRNPD" proteins (16)
SKU Description Size Price
PH300660 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_002129) 10 ug
$3,360.00
PH301796 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112738) 10 ug
$3,360.00
PH320809 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_001003810) 10 ug
$3,360.00
PH322094 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112737) 10 ug
$3,360.00
LC410547 Lyophilized HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410548 Lyophilized HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419510 Lyophilized HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424021 Lyophilized HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410547 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410548 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY419510 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY424021 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP301796 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1, 20 µg 20 ug
$737.00
TP320809 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4, 20 µg 20 ug
$737.00
TP322094 Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2, 20 µg 20 ug
$737.00
TP760280 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

A common intronic variant of PARP1 confers melanoma risk and mediates melanocyte growth via regulation of MITF
Choi, Xu, Makowski et al
Nat Genet (2017) 49 (9), 1326-1335 DOI: 10.1038/ng.3927
Cited by 68
AI Summary: In this paper, OriGene products—specifically the PARP1 cDNA clone (RC204232) and PARP1 shRNA (TL309386)—were used to modulate PARP1 expression in melanocyte experiments, enabling the authors to investigate how PARP1 influences cell proliferation and senescence in the context of melanoma risk.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products