HNRNPD (NM_031369) Human Mass Spec Standard

SKU
PH322094
HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112737)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222094]
Predicted MW 36.1 kDa
Protein Sequence
Protein Sequence
>RC222094 representing NM_031369
Red=Cloning site Green=Tags(s)

MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDA
SKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKE
HKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFIT
FKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWN
QGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112737
RefSeq Size 2200
RefSeq ORF 1008
Synonyms AUF1; AUF1A; hnRNPD0; HNRPD; P37
Locus ID 3184
UniProt ID Q14103
Cytogenetics 4q21.22
Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:HNRNPD (NM_031369) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300660 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_002129) 10 ug
$3,255.00
PH301796 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112738) 10 ug
$3,255.00
PH320809 HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_001003810) 10 ug
$3,255.00
LC410547 HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410548 HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419510 HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424021 HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410547 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2 100 ug
$436.00
LY410548 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1 100 ug
$436.00
LY419510 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3 100 ug
$436.00
LY424021 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4 100 ug
$436.00
TP300660 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, 20 µg 20 ug
$737.00
TP301796 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1, 20 µg 20 ug
$737.00
TP320809 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4, 20 µg 20 ug
$737.00
TP322094 Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2, 20 µg 20 ug
$737.00
TP760280 Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.