OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Apoptosis repressor with CARD (NOL3) (NM_003946) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300591
Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349490 Rabbit Polyclonal Anti-NOL3 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Apoptosis repressor with CARD or NM_003946"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200591 protein sequence
Red=Cloning site Green=Tags(s)

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE
AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE
GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003937
Locus ID 8996
UniProt ID O60936
Cytogenetics 16q22.1
RefSeq Size 1540
RefSeq ORF 624
Synonyms ARC; FCM; MYOCL1; MYP; NOP; NOP30
Summary This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jun 2010
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Apoptosis repressor with CARD" proteins (4)
SKU Description Size Price
PH300591 NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937) 10 ug
$3,360.00
LC401296 Lyophilized NOL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401296 Transient overexpression lysate of nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3) (as WB positive control) 100 ug
$436.00
TP720132 Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 3. 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products