Apoptosis repressor with CARD (NOL3) (NM_003946) Human Mass Spec Standard

SKU
PH300591
NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200591]
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC200591 protein sequence
Red=Cloning site Green=Tags(s)

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE
AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE
GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003937
RefSeq Size 1540
RefSeq ORF 624
Synonyms ARC; FCM; MYOCL1; MYP; NOP; NOP30
Locus ID 8996
UniProt ID O60936
Cytogenetics 16q22.1
Summary This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:Apoptosis repressor with CARD (NOL3) (NM_003946) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401296 NOL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401296 Transient overexpression lysate of nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3) 100 ug
$436.00
TP300591 Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720132 Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 3. 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.