Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Recombinant Protein

SKU
TP300406
Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200406 protein sequence
Red=Cloning site Green=Tags(s)

MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR
CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG
TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT
LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ
ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003355
Locus ID 7378
UniProt ID Q16831
Cytogenetics 7p12.3
RefSeq Size 1733
RefSeq ORF 930
Synonyms UDRPASE; UP; UPASE; UPP
Summary This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016]
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300406 UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_003355) 10 ug
$3,255.00
PH319125 UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628) 10 ug
$3,255.00
LC405710 UPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418738 UPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429141 UPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405710 Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 2 100 ug
$436.00
LY418738 Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 100 ug
$436.00
LY429141 Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 100 ug
$436.00
TP319125 Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720926 Purified recombinant protein of Human uridine phosphorylase 1 (UPP1), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.