Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Mass Spec Standard

SKU
PH300406
UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_003355)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200406]
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC200406 protein sequence
Red=Cloning site Green=Tags(s)

MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR
CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG
TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT
LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ
ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003355
RefSeq Size 1733
RefSeq ORF 930
Synonyms UDRPASE; UP; UPASE; UPP
Locus ID 7378
UniProt ID Q16831
Cytogenetics 7p12.3
Summary This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016]
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319125 UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628) 10 ug
$3,255.00
LC405710 UPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418738 UPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429141 UPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405710 Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 2 100 ug
$436.00
LY418738 Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 100 ug
$436.00
LY429141 Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 100 ug
$436.00
TP300406 Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319125 Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720926 Purified recombinant protein of Human uridine phosphorylase 1 (UPP1), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.