Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200406] |
Predicted MW | 33.9 kDa |
Protein Sequence |
Protein Sequence
>RC200406 protein sequence
Red=Cloning site Green=Tags(s) MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003355 |
RefSeq Size | 1733 |
RefSeq ORF | 930 |
Synonyms | UDRPASE; UP; UPASE; UPP |
Locus ID | 7378 |
UniProt ID | Q16831 |
Cytogenetics | 7p12.3 |
Summary | This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016] |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319125 | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628) | 10 ug |
$3,255.00
|
|
LC405710 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418738 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429141 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405710 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY418738 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 | 100 ug |
$436.00
|
|
LY429141 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 | 100 ug |
$436.00
|
|
TP300406 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP319125 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720926 | Purified recombinant protein of Human uridine phosphorylase 1 (UPP1), transcript variant 1 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.