Uridine Phosphorylase 1 (UPP1) Rabbit Polyclonal Antibody

SKU TA346356

Rabbit Polyclonal Anti-UPP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UPP1 antibody: synthetic peptide directed towards the middle region of human UPP1. Synthetic peptide located within the following region: ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: uridine phosphorylase 1
• Database Link:
  NP_003355
  Q16831
• Background: UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
• Synonyms: UDRPASE; UP; UPASE; UPP
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Zebrafish: 100%; Dog: 92%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85%; Rabbit: 77%

Reference Data

• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism