OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSF2 (GINS2) (NM_016095) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300011
Recombinant protein of human GINS complex subunit 2 (Psf2 homolog) (GINS2), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366142 GINS2 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PSF2 or NM_016095"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200011 protein sequence
Red=Cloning site Green=Tags(s)

MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK
LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE
AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057179
Locus ID 51659
UniProt ID Q9Y248
Cytogenetics 16q24.1
RefSeq Size 1196
RefSeq ORF 555
Synonyms HSPC037; Pfs2; PSF2
Summary The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 PubMed 16287864). See GINS1 for additional information about the GINS complex.supplied by OMIM, Mar 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSF2" proteins (3)
SKU Description Size Price
PH300011 GINS2 MS Standard C13 and N15-labeled recombinant protein (NP_057179) 10 ug
$3,360.00
LC402499 Lyophilized GINS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402499 Transient overexpression lysate of GINS complex subunit 2 (Psf2 homolog) (GINS2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products