PSF2 (GINS2) (NM_016095) Human Recombinant Protein

SKU TP300011

Recombinant protein of human GINS complex subunit 2 (Psf2 homolog) (GINS2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200011 protein sequence; Red=Cloning site Green=Tags(s); ; MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK; LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE; AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057179
• Locus ID: 51659
• UniProt ID: Q9Y248
• Cytogenetics: 16q24.1
• RefSeq Size: 1196
• RefSeq ORF: 555
• Synonyms: HSPC037; Pfs2; PSF2
• Summary: The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome