PSF2 (GINS2) (NM_016095) Human Tagged ORF Clone

SKU
RC200011
GINS2 (Myc-DDK-tagged)-Human GINS complex subunit 2 (Psf2 homolog) (GINS2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSF2
Synonyms HSPC037; Pfs2; PSF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200011 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCTGCCGAGGTCGAATTCCTCGCCGAGAAGGAGCTGGTTACCATTATCCCCAACTTCAGTCTGG
ACAAGATCTACCTCATCGGGGGGGACCTGGGGCCTTTTAACCCTGGTTTACCCGTGGAAGTGCCCCTGTG
GCTGGCGATTAACCTGAAACAAAGACAGAAATGTCGCCTGCTCCCTCCAGAGTGGATGGATGTAGAAAAG
TTGGAGAAGATGAGGGATCATGAACGAAAGGAAGAAACTTTTACCCCAATGCCCAGCCCTTACTACATGG
AACTTACGAAGCTCCTGTTAAATCATGCTTCAGACAACATCCCGAAGGCAGACGAAATCCGGACCCTGGT
CAAGGATATGTGGGACACTCGTATAGCCAAACTCCGAGTGTCTGCTGACAGCTTTGTGAGACAGCAGGAG
GCACATGCCAAGCTGGATAACTTGACCTTGATGGAGATCAACACCAGCGGGACTTTCCTCACACAAGCGC
TCAACCACATGTACAAACTCCGCACAAACCTCCAGCCTCTGGAGAGTACTCAGTCTCAGGACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200011 protein sequence
Red=Cloning site Green=Tags(s)

MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK
LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE
AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016095
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016095.3
RefSeq Size 1196 bp
RefSeq ORF 558 bp
Locus ID 51659
UniProt ID Q9Y248
Cytogenetics 16q24.1
Domains DUF392
Protein Families Druggable Genome
MW 21.4 kDa
Summary The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:PSF2 (GINS2) (NM_016095) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200011L1 Lenti ORF clone of Human GINS complex subunit 2 (Psf2 homolog) (GINS2), Myc-DDK-tagged 10 ug
$600.00
RC200011L2 Lenti ORF clone of Human GINS complex subunit 2 (Psf2 homolog) (GINS2), mGFP tagged 10 ug
$600.00
RC200011L3 Lenti ORF clone of Human GINS complex subunit 2 (Psf2 homolog) (GINS2), Myc-DDK-tagged 10 ug
$600.00
RC200011L4 Lenti ORF clone of Human GINS complex subunit 2 (Psf2 homolog) (GINS2), mGFP tagged 10 ug
$600.00
RG200011 GINS2 (tGFP-tagged) - Human GINS complex subunit 2 (Psf2 homolog) (GINS2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC104163 GINS2 (untagged)-Human GINS complex subunit 2 (Psf2 homolog) (GINS2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.