PSF2 (GINS2) (NM_016095) Human Mass Spec Standard

SKU PH300011

GINS2 MS Standard C13 and N15-labeled recombinant protein (NP_057179)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200011]
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC200011 protein sequence; Red=Cloning site Green=Tags(s); ; MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK; LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE; AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057179
• RefSeq Size: 1196
• RefSeq ORF: 555
• Synonyms: HSPC037; Pfs2; PSF2
• Locus ID: 51659
• UniProt ID: Q9Y248
• Cytogenetics: 16q24.1
• Summary: The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome