CD133 (PROM1) (NM_001145847) Human Mass Spec Standard

SKU
PH327854
PROM1 MS Standard C13 and N15-labeled recombinant protein (NP_001139319)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227854]
Predicted MW 96.3 kDa
Protein Sequence
Protein Sequence
>RC227854 protein sequence
Red=Cloning site Green=Tags(s)

MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRD
FPEDTLRKFLQKAYESKIDYDKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKE
NGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQY
NTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSS
SLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQ
GYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEE
YDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLSFLFCWILMI
IVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGT
YGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTG
KSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGL
LERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAV
DVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKD
HVYGIHNPVMTSPSQH

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139319
RefSeq Size 4257
RefSeq ORF 2568
Synonyms AC133; CD133; CORD12; MCDR2; MSTP061; PROML1; RP41; STGD4
Locus ID 8842
UniProt ID O43490
Cytogenetics 4p15.32
Summary This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Write Your Own Review
You're reviewing:CD133 (PROM1) (NM_001145847) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321611 PROM1 MS Standard C13 and N15-labeled recombinant protein (NP_006008) 10 ug
$3,255.00
LC416886 PROM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429028 PROM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416886 Transient overexpression lysate of prominin 1 (PROM1), transcript variant 1 100 ug
$665.00
LY429028 Transient overexpression lysate of prominin 1 (PROM1), transcript variant 2 100 ug
$665.00
TP321611 Recombinant protein of human prominin 1 (PROM1), transcript variant 1, 20 µg 20 ug
$737.00
TP327854 Recombinant protein of human prominin 1 (PROM1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.