Estrogen Receptor 1 (ESR1) (NM_001122741) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226004] |
Predicted MW | 66 kDa |
Protein Sequence |
Protein Sequence
>RC226004 representing NM_001122741
Red=Cloning site Green=Tags(s) MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001116213 |
RefSeq ORF | 1785 |
Synonyms | ER; Era; ESR; ESRA; ESTRR; NR3A1 |
Locus ID | 2099 |
UniProt ID | P03372 |
Cytogenetics | 6q25.1-q25.2 |
Summary | This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313277 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_000116) | 10 ug |
$3,255.00
|
|
PH326003 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_001116212) | 10 ug |
$3,255.00
|
|
LC400046 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426553 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426554 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426555 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400046 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 1 | 100 ug |
$665.00
|
|
LY426553 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 2 | 100 ug |
$436.00
|
|
LY426554 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 3 | 100 ug |
$436.00
|
|
LY426555 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 4 | 100 ug |
$436.00
|
|
TP313277 | Recombinant protein of human estrogen receptor 1 (ESR1), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP326003 | Purified recombinant protein of Homo sapiens estrogen receptor 1 (ESR1), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP326004 | Purified recombinant protein of Homo sapiens estrogen receptor 1 (ESR1), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP720514 | Recombinant protein of human estrogen receptor 1 (ESR1), transcript variant 1 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.