p73 (TP73) (NM_001126242) Human Mass Spec Standard

SKU
PH325696
TP73 MS Standard C13 and N15-labeled recombinant protein (NP_001119714)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225696]
Predicted MW 47.5 kDa
Protein Sequence
Protein Sequence
>RC225696 representing NM_001126242
Red=Cloning site Green=Tags(s)

MLYVGDPARHLATAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNT
DYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTD
VVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCN
SSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRA
FKQSPPAVPALGAGVKKRRHGDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRP
PRDAQQPWPRSASQRRDEQQPQRPVHGLGVPLHSATPLPRRPQPRQFFNRIGVSKLHRVFHLPRVTEHLP
PAEPDH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001119714
RefSeq ORF 1278
Synonyms P73
Locus ID 7161
UniProt ID O15350
Cytogenetics 1p36.32
Summary This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined. [provided by RefSeq, Feb 2011]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Neurotrophin signaling pathway, p53 signaling pathway
Write Your Own Review
You're reviewing:p73 (TP73) (NM_001126242) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320864 TP73 MS Standard C13 and N15-labeled recombinant protein (NP_005418) 10 ug
$3,255.00
LC417321 TP73 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426670 TP73 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417321 Transient overexpression lysate of tumor protein p73 (TP73), transcript variant 1 100 ug
$665.00
LY426670 Transient overexpression lysate of tumor protein p73 (TP73), transcript variant 4 100 ug
$436.00
TP320864 Recombinant protein of human tumor protein p73 (TP73), transcript variant 1, 20 µg 20 ug
$867.00
TP325696 Purified recombinant protein of Homo sapiens tumor protein p73 (TP73), transcript variant 4, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.