DIABLO (NM_138929) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224190] |
Predicted MW | 15.9 kDa |
Protein Sequence |
Protein Sequence
>RC224190 representing NM_138929
Red=Cloning site Green=Tags(s) MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQAVYTLTSLY RQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITAR NHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_620307 |
RefSeq Size | 1366 |
RefSeq ORF | 585 |
Synonyms | DFNA64; DIABLO-S; SMAC; SMAC3 |
Locus ID | 56616 |
UniProt ID | Q9NR28 |
Cytogenetics | 12q24.31 |
Summary | This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH324145 | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308) | 10 ug |
$3,255.00
|
|
LC408473 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC412673 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429603 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408473 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2 | 100 ug |
$436.00
|
|
LY412673 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 1 | 100 ug |
$436.00
|
|
TP324145 | Purified recombinant protein of Homo sapiens diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP324190 | Recombinant protein of human diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.