DIABLO (NM_138930) Human Mass Spec Standard

SKU
PH324145
DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224145]
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC224145 representing NM_138930
Red=Cloning site Green=Tags(s)

MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGK
MNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQ
VEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620308
RefSeq Size 2455
RefSeq ORF 558
Synonyms DFNA64; SMAC
Locus ID 56616
UniProt ID Q9NR28
Cytogenetics 12q24.31
Summary This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:DIABLO (NM_138930) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH324190 DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620307) 10 ug
$3,255.00
LC408473 DIABLO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412673 DIABLO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429603 DIABLO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408473 Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY412673 Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP324145 Purified recombinant protein of Homo sapiens diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324190 Recombinant protein of human diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.