Rapsyn (RAPSN) (NM_005055) Human Mass Spec Standard

SKU
PH322710
RAPSN MS Standard C13 and N15-labeled recombinant protein (NP_005046)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222710]
Predicted MW 46.1 kDa
Protein Sequence
Protein Sequence
>RC222710 representing NM_005055
Red=Cloning site Green=Tags(s)

MGQDQTKKQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYKEMLKFAVVQI
DTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQ
KALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNNYGKGWSLKYRAMSQY
HMAVAYRLLGRLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIG
NRLGQVQALLGVAKCWVARKALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVV
RFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005046
RefSeq Size 1664
RefSeq ORF 1236
Synonyms CMS4C; CMS11; FADS; FADS2; RAPSYN; RNF205
Locus ID 5913
UniProt ID Q13702
Cytogenetics 11p11.2
Summary This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Rapsyn (RAPSN) (NM_005055) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403186 RAPSN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417541 RAPSN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403186 Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 2 100 ug
$436.00
LY417541 Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 1 100 ug
$436.00
TP322710 Recombinant protein of human receptor-associated protein of the synapse (RAPSN), transcript variant 1, 20 µg 20 ug
$737.00
TP762566 Purified recombinant protein of Human receptor-associated protein of the synapse (RAPSN), transcript variant 2, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.