Rapsyn (RAPSN) (NM_005055) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222710] |
Predicted MW | 46.1 kDa |
Protein Sequence |
Protein Sequence
>RC222710 representing NM_005055
Red=Cloning site Green=Tags(s) MGQDQTKKQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYKEMLKFAVVQI DTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQ KALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNNYGKGWSLKYRAMSQY HMAVAYRLLGRLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIG NRLGQVQALLGVAKCWVARKALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVV RFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005046 |
RefSeq Size | 1664 |
RefSeq ORF | 1236 |
Synonyms | CMS4C; CMS11; FADS; FADS2; RAPSYN; RNF205 |
Locus ID | 5913 |
UniProt ID | Q13702 |
Cytogenetics | 11p11.2 |
Summary | This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403186 | RAPSN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417541 | RAPSN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403186 | Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 2 | 100 ug |
$436.00
|
|
LY417541 | Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 1 | 100 ug |
$436.00
|
|
TP322710 | Recombinant protein of human receptor-associated protein of the synapse (RAPSN), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP762566 | Purified recombinant protein of Human receptor-associated protein of the synapse (RAPSN), transcript variant 2, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.