Calpastatin (CAST) (NM_173061) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222278] |
Predicted MW | 46.9 kDa |
Protein Sequence |
Protein Sequence
>RC222278 representing NM_173061
Red=Cloning site Green=Tags(s) MGQFLSSTFLEGSPATVWHDKLCDGERRGAREAVRIFQDQAKAKEEKLEKCGEDDETIPSEYRLKPATDK DGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQS APPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVK DKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPP RDTSSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQD KPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKT TEETSKPKDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_775084 |
RefSeq Size | 1889 |
RefSeq ORF | 1290 |
Synonyms | BS-17; calpain inhibitor; calpastatin; heart-type calpastatin; MGC9402; OTTHUMP00000158519; OTTHUMP00000158520; sperm BS-17 component |
Locus ID | 831 |
UniProt ID | P20810 |
Cytogenetics | 5q15 |
Summary | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302168 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) | 10 ug |
$3,255.00
|
|
PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) | 10 ug |
$3,255.00
|
|
LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 | 100 ug |
$665.00
|
|
LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 | 100 ug |
$665.00
|
|
LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 | 100 ug |
$436.00
|
|
LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 | 100 ug |
$665.00
|
|
TP302168 | Recombinant protein of human calpastatin (CAST), transcript variant 10, 20 µg | 20 ug |
$737.00
|
|
TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP322278 | Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.