Calpastatin (CAST) (NM_001042444) Human Mass Spec Standard

SKU
PH302168
CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202168]
Predicted MW 71.9 kDa
Protein Sequence
Protein Sequence
>RC202168 protein sequence
Red=Cloning site Green=Tags(s)

MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGG
ESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPE
VSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKT
EKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAK
EEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK
TEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEK
AKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFE
DAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKA
EHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNT
AKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035909
RefSeq Size 4366
RefSeq ORF 2001
Synonyms BS-17; PLACK
Locus ID 831
UniProt ID P20810
Cytogenetics 5q15
Summary The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:Calpastatin (CAST) (NM_001042444) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311776 CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) 10 ug
$3,255.00
PH322278 CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084) 10 ug
$3,255.00
LC400663 CAST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406666 CAST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420908 CAST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434378 CAST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400663 Transient overexpression lysate of calpastatin (CAST), transcript variant 1 100 ug
$665.00
LY406666 Transient overexpression lysate of calpastatin (CAST), transcript variant 2 100 ug
$665.00
LY420908 Transient overexpression lysate of calpastatin (CAST), transcript variant 10 100 ug
$436.00
LY434378 Transient overexpression lysate of calpastatin (CAST), transcript variant 11 100 ug
$665.00
TP302168 Recombinant protein of human calpastatin (CAST), transcript variant 10, 20 µg 20 ug
$737.00
TP311776 Recombinant protein of human calpastatin (CAST), transcript variant 1, 20 µg 20 ug
$737.00
TP322278 Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.