CPVL (NM_019029) Human Mass Spec Standard

SKU
PH320622
CPVL MS Standard C13 and N15-labeled recombinant protein (NP_061902)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220622]
Predicted MW 54.2 kDa
Protein Sequence
Protein Sequence
>RC220622 protein sequence
Red=Cloning site Green=Tags(s)

MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN
MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF
PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV
PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK
QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK
IFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061902
RefSeq Size 1779
RefSeq ORF 1428
Synonyms HVLP
Locus ID 54504
UniProt ID Q9H3G5
Cytogenetics 7p14.3
Summary The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome, Protease
Write Your Own Review
You're reviewing:CPVL (NM_019029) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302336 CPVL MS Standard C13 and N15-labeled recombinant protein (NP_112601) 10 ug
$3,255.00
LC410561 CPVL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412799 CPVL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410561 Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 100 ug
$436.00
LY412799 Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 100 ug
$436.00
TP302336 Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1, 20 µg 20 ug
$737.00
TP320622 Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2, 20 µg 20 ug
$737.00
TP721099 Purified recombinant protein of Human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.