CPVL (NM_031311) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202336] |
Predicted MW | 54.2 kDa |
Protein Sequence |
Protein Sequence
>RC202336 protein sequence
Red=Cloning site Green=Tags(s) MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK IFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_112601 |
RefSeq Size | 1691 |
RefSeq ORF | 1428 |
Synonyms | HVLP |
Locus ID | 54504 |
UniProt ID | Q9H3G5 |
Cytogenetics | 7p14.3 |
Summary | The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Protease |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH320622 | CPVL MS Standard C13 and N15-labeled recombinant protein (NP_061902) | 10 ug |
$3,255.00
|
|
LC410561 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC412799 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410561 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 | 100 ug |
$436.00
|
|
LY412799 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 | 100 ug |
$436.00
|
|
TP302336 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP320622 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP721099 | Purified recombinant protein of Human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.