CPVL (NM_031311) Human Recombinant Protein

SKU
TP302336
Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202336 protein sequence
Red=Cloning site Green=Tags(s)

MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN
MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF
PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV
PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK
QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK
IFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112601
Locus ID 54504
UniProt ID Q9H3G5
Cytogenetics 7p14.3
RefSeq Size 1691
RefSeq ORF 1428
Synonyms HVLP
Summary The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome, Protease
Write Your Own Review
You're reviewing:CPVL (NM_031311) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302336 CPVL MS Standard C13 and N15-labeled recombinant protein (NP_112601) 10 ug
$3,255.00
PH320622 CPVL MS Standard C13 and N15-labeled recombinant protein (NP_061902) 10 ug
$3,255.00
LC410561 CPVL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412799 CPVL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410561 Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 100 ug
$436.00
LY412799 Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 100 ug
$436.00
TP320622 Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2, 20 µg 20 ug
$737.00
TP721099 Purified recombinant protein of Human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.