TCF21 (NM_198392) Human Mass Spec Standard

SKU PH320002

TCF21 MS Standard C13 and N15-labeled recombinant protein (NP_938206)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC220002]
• Predicted MW: 19.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC220002 representing NM_198392; Red=Cloning site Green=Tags(s); ; MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS; GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY; ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_938206
• RefSeq Size: 3231
• RefSeq ORF: 537
• Synonyms: bHLHa23; POD1
• Locus ID: 6943
• UniProt ID: O43680
• Cytogenetics: 6q23.2
• Summary: TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors