TCF21 (NM_198392) Human Tagged ORF Clone

SKU
RC220002
TCF21 (Myc-DDK-tagged)-Human transcription factor 21 (TCF21), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TCF21
Synonyms bHLHa23; POD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220002 representing NM_198392
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACCGGCTCCCTCAGCGATGTGGAGGACCTTCAAGAGGTGGAGATGTTGGAATGTGACGGGTTGA
AAATGGATTCGAACAAGGAATTTGTGACTTCCAACGAGAGCACCGAGGAGAGCTCCAACTGCGAGAATGG
GTCTCCCCAGAAGGGCCGCGGCGGCCTGGGCAAGAGGAGGAAGGCGCCCACCAAGAAGAGCCCCCTGAGC
GGGGTCAGCCAGGAGGGGAAGCAGGTCCAGCGCAACGCCGCCAACGCGCGAGAGCGGGCCCGCATGCGAG
TGCTGAGCAAGGCCTTCTCCAGACTCAAGACCACCCTGCCCTGGGTGCCCCCCGACACCAAGCTCTCCAA
GCTGGACACGCTCAGGCTGGCGTCCAGCTACATCGCCCACTTGAGGCAGATCCTGGCTAACGACAAATAC
GAGAACGGGTACATTCACCCGGTCAACCTGACGTGGCCCTTTATGGTGGCCGGGAAACCCGAGAGTGACC
TGAAAGAAGTGGTGACCGCGAGCCGCTTATGTGGAACCACCGCGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220002 representing NM_198392
Red=Cloning site Green=Tags(s)

MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS
GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY
ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198392
ORF Size 537 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198392.3
RefSeq Size 3231 bp
RefSeq ORF 540 bp
Locus ID 6943
UniProt ID O43680
Cytogenetics 6q23.2
Protein Families Druggable Genome, Transcription Factors
MW 19.5 kDa
Summary TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TCF21 (NM_198392) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220002L3 Lenti ORF clone of Human transcription factor 21 (TCF21), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC220002L4 Lenti ORF clone of Human transcription factor 21 (TCF21), transcript variant 1, mGFP tagged 10 ug
$750.00
RG220002 TCF21 (tGFP-tagged) - Human transcription factor 21 (TCF21), transcript variant 1 10 ug
$650.00
SC125048 TCF21 (untagged)-Human transcription factor 21 (TCF21), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.