FAK (PTK2) (NM_153831) Human Mass Spec Standard

SKU
PH319839
PTK2 MS Standard C13 and N15-labeled recombinant protein (NP_722560)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219839]
Predicted MW 119.1 kDa
Protein Sequence
Protein Sequence
>RC219839 representing NM_153831
Red=Cloning site Green=Tags(s)

MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQK
IVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTED
KPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKS
LLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGI
SYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRL
VNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI
TENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCV
KLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNND
VIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQAT
VSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQ
TDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKPWRLQPQ
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPA
STHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG
QTRPH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_722560
RefSeq Size 4453
RefSeq ORF 3165
Synonyms FADK; FADK 1; FAK; FAK1; FRNK; p125FAK; pp125FAK; PPP1R71
Locus ID 5747
UniProt ID Q05397
Cytogenetics 8q24.3
Summary This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Axon guidance, Chemokine signaling pathway, ErbB signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer, VEGF signaling pathway
Write Your Own Review
You're reviewing:FAK (PTK2) (NM_153831) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321398 PTK2 MS Standard C13 and N15-labeled recombinant protein (NP_005598) 10 ug
$3,255.00
LC403521 PTK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417186 PTK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429259 PTK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403521 Transient overexpression lysate of PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 1 100 ug
$665.00
LY417186 Transient overexpression lysate of PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2 100 ug
$665.00
LY429259 Transient overexpression lysate of PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2 100 ug
$665.00
TP319839 Recombinant protein of human PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 1, 20 µg 20 ug
$867.00
TP321398 Recombinant protein of human PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.