Sterol carrier protein 2 (SCP2) (NM_001007100) Human Mass Spec Standard

SKU
PH318251
SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_001007101)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218251]
Predicted MW 15.08 kDa
Protein Sequence
Protein Sequence
>RC218251 representing NM_001007100
Red=Cloning site Green=Tags(s)

MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVD
VKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007101
RefSeq Size 1438
RefSeq ORF 420
Synonyms NLTP; NSL-TP; SCOX; SCP-2; SCP-CHI; SCP-X; SCPX
Locus ID 6342
UniProt ID P22307
Cytogenetics 1p32.3
Summary This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]
Protein Pathways Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis
Write Your Own Review
You're reviewing:Sterol carrier protein 2 (SCP2) (NM_001007100) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319802 SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_002970) 10 ug
$3,255.00
LC401042 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422797 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422798 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434253 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434278 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434294 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401042 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 1 100 ug
$665.00
LY422797 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 3 100 ug
$436.00
LY422798 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 4 100 ug
$436.00
LY434253 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 8 100 ug
$436.00
LY434278 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 6 100 ug
$436.00
LY434294 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 7 100 ug
$436.00
TP318251 Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319802 Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.