Sterol carrier protein 2 (SCP2) (NM_001007100) Human Tagged ORF Clone

SKU
RC218251
SCP2 (Myc-DDK-tagged)-Human sterol carrier protein 2 (SCP2), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Sterol carrier protein 2
Synonyms NLTP; NSL-TP; SCOX; SCP-2; SCP-CHI; SCP-X; SCPX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218251 representing NM_001007100
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGAT
TTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAA
AATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGAT
GTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGATAAGAAGGCTGACTGCACAATCACAATGGCTG
ACTCAGACTTCCTGGCTTTAATGACTGGTAAAATGAATCCTCAGTCGGCCTTCTTTCAAGGCAAATTGAA
AATCACTGGCAACATGGGTCTCGCTATGAAGTTACAAAATCTTCAGCTTCAGCCAGGCAACGCTAAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218251 representing NM_001007100
Red=Cloning site Green=Tags(s)

MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVD
VKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001007100
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007100.3
RefSeq Size 1438 bp
RefSeq ORF 423 bp
Locus ID 6342
UniProt ID P22307
Cytogenetics 1p32.3
Protein Pathways Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis
MW 15.08 kDa
Summary This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:Sterol carrier protein 2 (SCP2) (NM_001007100) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218251L3 Lenti ORF clone of Human sterol carrier protein 2 (SCP2), transcript variant 4, Myc-DDK-tagged 10 ug
$450.00
RC218251L4 Lenti ORF clone of Human sterol carrier protein 2 (SCP2), transcript variant 4, mGFP tagged 10 ug
$450.00
RG218251 SCP2 (tGFP-tagged) - Human sterol carrier protein 2 (SCP2), transcript variant 4 10 ug
$350.00
SC301155 SCP2 (untagged)-Human sterol carrier protein 2 (SCP2), transcript variant 4 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.