Sterol carrier protein 2 (SCP2) (NM_002979) Human Recombinant Protein

SKU
TP319802
Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219802 representing NM_002979
Red=Cloning site Green=Tags(s)

MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDST
CGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPT
DKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVM
ASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDM
SKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGL
ISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSD
KKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002970
Locus ID 6342
UniProt ID P22307
Cytogenetics 1p32.3
RefSeq Size 2697
RefSeq ORF 1641
Synonyms NLTP; NSL-TP; SCOX; SCP-2; SCP-CHI; SCP-X; SCPX
Summary This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]
Protein Pathways Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis
Write Your Own Review
You're reviewing:Sterol carrier protein 2 (SCP2) (NM_002979) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318251 SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_001007101) 10 ug
$3,255.00
PH319802 SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_002970) 10 ug
$3,255.00
LC401042 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422797 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422798 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434253 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434278 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434294 SCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401042 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 1 100 ug
$665.00
LY422797 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 3 100 ug
$436.00
LY422798 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 4 100 ug
$436.00
LY434253 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 8 100 ug
$436.00
LY434278 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 6 100 ug
$436.00
LY434294 Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 7 100 ug
$436.00
TP318251 Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.