PKC epsilon (PRKCE) (NM_005400) Human Mass Spec Standard

SKU
PH317702
PRKCE MS Standard C13 and N15-labeled recombinant protein (NP_005391)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217702]
Predicted MW 83.5 kDa
Protein Sequence
Protein Sequence
>RC217702 representing NM_005400
Red=Cloning site Green=Tags(s)

MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFV
TDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPK
DNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHK
RCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNV
HRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTS
PCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVN
GGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILN
GVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWL
SKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQ
DFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005391
RefSeq Size 5537
RefSeq ORF 2211
Synonyms nPKC-epsilon; PKCE
Locus ID 5581
UniProt ID Q02156
Cytogenetics 2p21
Summary Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Tight junction, Type II diabetes mellitus, Vascular smooth muscle contraction
Write Your Own Review
You're reviewing:PKC epsilon (PRKCE) (NM_005400) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401658 PRKCE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401658 Transient overexpression lysate of protein kinase C, epsilon (PRKCE) 100 ug
$665.00
TP317702 Recombinant protein of human protein kinase C, epsilon (PRKCE), 20 µg 20 ug
$737.00
TP710186 Purified recombinant protein of Human protein kinase C, epsilon (PRKCE), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP720143 Recombinant protein of human protein kinase C, epsilon (PRKCE) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.