CD22 (NM_001771) Human Mass Spec Standard

SKU
PH316939
CD22 MS Standard C13 and N15-labeled recombinant protein (NP_001762)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216939]
Predicted MW 95.8 kDa
Protein Sequence
Protein Sequence
>RC216939 representing NM_001771
Red=Cloning site Green=Tags(s)

MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSK
FDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERP
FPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQW
SHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWL
KDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVE
FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACARCNSW
CSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDS
ISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWF
DWNNQSLPHHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILI
LAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEM
NIPRTGDAESSEMQRPPRTCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV
DYVILKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001762
RefSeq Size 3300
RefSeq ORF 2541
Synonyms SIGLEC-2; SIGLEC2
Locus ID 933
UniProt ID P20273
Cytogenetics 19q13.12
Summary Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Protein Pathways B cell receptor signaling pathway, Cell adhesion molecules (CAMs), Hematopoietic cell lineage
Write Your Own Review
You're reviewing:CD22 (NM_001771) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC434364 CD22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY434364 Transient overexpression lysate of CD22 molecule (CD22), transcript variant 4 100 ug
$665.00
TP316939 Recombinant protein of human CD22 molecule (CD22), 20 µg 20 ug
$737.00
TP721302 Human CD22 Protein (C-His) 25 ug
$300.00
TP721303 Human CD22 Protein (C-His-Avi) 25 ug
$300.00
TP721304 Biotinylated Human CD22 Protein (C-His-Avi) 25 ug
$430.00
TP721305 PE Conjugated Human CD22 Protein (C-His) 25 ug
$430.00
TP721306 APC Conjugated Human CD22 Protein (C-His) 25 ug
$430.00
TP721307 Human CD22 Protein (C-Fc) 25 ug
$300.00
TP723928 Human CD22 Protein, hFc-His Tag 100 ug
$650.00
TP762390 Purified recombinant protein of Human CD22 molecule (CD22), transcript variant 1, Asp20-Ala330, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.