OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSI1 (NM_002442) Human Mass Spec Standard

Be the first to review this product
SKU
PH315992
MSI1 MS Standard C13 and N15-labeled recombinant protein (NP_002433)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502198 MSI1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8) 100 ul
$447.00
LY419331 Transient overexpression lysate of musashi homolog 1 (Drosophila) (MSI1) (as WB positive control) 100 ug
$436.00

Other products for "MSI1 or NM_002442"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215992
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC215992 representing NM_002442
Red=Cloning site Green=Tags(s)

METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD
QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAML
MFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAF
MLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAA
AVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGG
PLIATAFTNGYH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002433
RefSeq Size 2950
RefSeq ORF 1086
Locus ID 4440
UniProt ID O43347
Cytogenetics 12q24.31
Summary This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSI1" proteins (3)
SKU Description Size Price
LC419331 Lyophilized MSI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419331 Transient overexpression lysate of musashi homolog 1 (Drosophila) (MSI1) (as WB positive control) 100 ug
$436.00
TP315992 Recombinant protein of human musashi homolog 1 (Drosophila) (MSI1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products