Glycerol kinase (GK) (NM_000167) Human Mass Spec Standard

SKU
PH313688
GK MS Standard C13 and N15-labeled recombinant protein (NP_000158)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213688]
Predicted MW 57.3 kDa
Protein Sequence
Protein Sequence
>RC213688 representing NM_000167
Red=Cloning site Green=Tags(s)

MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK
TCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSK
TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI
HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYG
TGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAK
EVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQ
INAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000158
RefSeq Size 3573
RefSeq ORF 1572
Synonyms GK1; GKD
Locus ID 2710
UniProt ID P32189
Cytogenetics Xp21.2
Summary The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway
Write Your Own Review
You're reviewing:Glycerol kinase (GK) (NM_000167) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307264 GK MS Standard C13 and N15-labeled recombinant protein (NP_976325) 10 ug
$3,255.00
LC404332 GK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424888 GK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404332 Transient overexpression lysate of glycerol kinase (GK), transcript variant 1 100 ug
$436.00
LY424888 Transient overexpression lysate of glycerol kinase (GK), transcript variant 2 100 ug
$436.00
TP307264 Recombinant protein of human glycerol kinase (GK), transcript variant 1, 20 µg 20 ug
$867.00
TP313688 Recombinant protein of human glycerol kinase (GK), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.