Glycerol kinase (GK) (NM_203391) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207264] |
Predicted MW | 58.2 kDa |
Protein Sequence |
Protein Sequence
>RC207264 protein sequence
Red=Cloning site Green=Tags(s) MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK TCEKLGQLKIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRITGNNNFVKSK TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQ AKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEE IEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD CGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTM ERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_976325 |
RefSeq Size | 4503 |
RefSeq ORF | 1590 |
Synonyms | GK1; GKD |
Locus ID | 2710 |
UniProt ID | P32189 |
Cytogenetics | Xp21.2 |
Summary | The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313688 | GK MS Standard C13 and N15-labeled recombinant protein (NP_000158) | 10 ug |
$3,255.00
|
|
LC404332 | GK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424888 | GK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404332 | Transient overexpression lysate of glycerol kinase (GK), transcript variant 1 | 100 ug |
$436.00
|
|
LY424888 | Transient overexpression lysate of glycerol kinase (GK), transcript variant 2 | 100 ug |
$436.00
|
|
TP307264 | Recombinant protein of human glycerol kinase (GK), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP313688 | Recombinant protein of human glycerol kinase (GK), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.