OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Glycerol kinase (GK) (NM_203391) Human Mass Spec Standard

Be the first to review this product
SKU
PH307264
GK MS Standard C13 and N15-labeled recombinant protein (NP_976325)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350026 Rabbit Polyclonal Anti-GK Antibody
100 ul
$205.00
LY424888 Transient overexpression lysate of glycerol kinase (GK), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Glycerol kinase or NM_203391"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207264
Predicted MW 58.2 kDa
Protein Sequence
Protein Sequence
>RC207264 protein sequence
Red=Cloning site Green=Tags(s)

MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK
TCEKLGQLKIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRITGNNNFVKSK
TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI
HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQ
AKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEE
IEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTM
ERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976325
RefSeq Size 4503
RefSeq ORF 1590
Synonyms GK1; GKD
Locus ID 2710
UniProt ID P32189
Cytogenetics Xp21.2
Summary The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2011
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Glycerol kinase" proteins (7)
SKU Description Size Price
PH313688 GK MS Standard C13 and N15-labeled recombinant protein (NP_000158) 10 ug
$3,360.00
LC404332 Lyophilized GK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424888 Lyophilized GK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404332 Transient overexpression lysate of glycerol kinase (GK), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424888 Transient overexpression lysate of glycerol kinase (GK), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307264 Recombinant protein of human glycerol kinase (GK), transcript variant 1, 20 µg 20 ug
$867.00
TP313688 Recombinant protein of human glycerol kinase (GK), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products