HSD17B13 (NM_178135) Human Mass Spec Standard

SKU
PH313132
HSD17B13 MS Standard C13 and N15-labeled recombinant protein (NP_835236)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213132]
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC213132 protein sequence
Red=Cloning site Green=Tags(s)

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
LNRMQNIQFEAVVGHKIKMK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_835236
RefSeq Size 2397
RefSeq ORF 900
Synonyms HMFN0376; NIIL497; SCDR9; SDR16C3
Locus ID 345275
UniProt ID Q7Z5P4
Cytogenetics 4q22.1
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:HSD17B13 (NM_178135) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405941 HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427863 HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC440268 HSD17B13, transcript variant D, HEK 293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC440269 HSD17B13, transcript variant C, HEK 293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405941 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A 100 ug
$436.00
LY427863 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant B 100 ug
$436.00
LY440268 Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant D 100 ug
$436.00
LY440269 Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant C 100 ug
$436.00
TP313132 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.