OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD17B13 (NM_178135) Human Mass Spec Standard

Be the first to review this product
SKU
PH313132
HSD17B13 MS Standard C13 and N15-labeled recombinant protein (NP_835236)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA592047 Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10
100 ul
$519.00
LY405941 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A (as WB positive control) 100 ug
$436.00

Other products for "HSD17B13 or NM_178135"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213132
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC213132 protein sequence
Red=Cloning site Green=Tags(s)

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
LNRMQNIQFEAVVGHKIKMK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_835236
RefSeq Size 2397
RefSeq ORF 900
Synonyms HMFN0376; NIIL497; SCDR9; SDR16C3
Locus ID 345275
UniProt ID Q7Z5P4
Cytogenetics 4q22.1
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSD17B13" proteins (9)
SKU Description Size Price
LC405941 Lyophilized HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427863 Lyophilized HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC440268 Lyophilized HSD17B13, transcript variant D, HEK 293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC440269 Lyophilized HSD17B13, transcript variant C, HEK 293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405941 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A (as WB positive control) 100 ug
$436.00
LY427863 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant B (as WB positive control) 100 ug
$436.00
LY440268 Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant D (as WB positive control) 100 ug
$436.00
LY440269 Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant C (as WB positive control) 100 ug
$436.00
TP313132 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products