HSD17B13 (NM_178135) Human Recombinant Protein

SKU
TP313132-B
Purified Biotinylated recombinant human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13) with C-terminal DDK tag and site-specific Biotinylation on the C-terminal AVIplus tag, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
2 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213132 protein sequence
Red=Cloning site Green=Tags(s)

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
LNRMQNIQFEAVVGHKIKMK

myc-FLAG tag
Tag C-DDK
Predicted MW 36.8KDa
Concentration >0.05 µg/µL as determined by Bradford protein assay method.
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity The biotin to protein ratio is about 0.2 as determined by Streptavidin Pull-Down Assay.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835236
Locus ID 345275
UniProt ID Q7Z5P4
Cytogenetics 4q22.1
RefSeq Size 2397
RefSeq ORF 900
Synonyms HMFN0376; NIIL497; SCDR9; SDR16C3
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:HSD17B13 (NM_178135) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.