TrkA (NTRK1) (NM_001012331) Human Mass Spec Standard

SKU
PH313091
NTRK1 MS Standard C13 and N15-labeled recombinant protein (NP_001012331)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213091]
Predicted MW 86.7 kDa
Protein Sequence
Protein Sequence
>RC213091 representing NM_001012331
Red=Cloning site Green=Tags(s)

MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE
LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL
QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD
VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNLTCWAENDVGRAEVSVQV
NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ
PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVGLAV
FACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY
FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM
LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA
GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTT
ESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKD
VHARLQALAQAPPVYLDVLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012331
RefSeq Size 2647
RefSeq ORF 2370
Synonyms MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Locus ID 4914
UniProt ID P04629
Cytogenetics 1q23.1
Summary This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Apoptosis, Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Thyroid cancer
Write Your Own Review
You're reviewing:TrkA (NTRK1) (NM_001012331) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400383 NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419273 NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423326 NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400383 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3 100 ug
$665.00
LY419273 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2 100 ug
$665.00
LY423326 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1 100 ug
$665.00
TP313091 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP700133 Purified recombinant protein of Human neurotrophic tyrosine kinase receptor, type 1, transcript variant 2, with C-terminal DDK/His tag, expressed in human cells 20 ug
$867.00
TP700134 Purified recombinant protein of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells 20 ug
$867.00
TP762465 Purified recombinant protein of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2, Asn440-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.