HSP90AA1 (NM_005348) Human Mass Spec Standard

SKU
PH312496
HSP90AA1 MS Standard C13 and N15-labeled recombinant protein (NP_005339)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212496]
Predicted MW 84.5 kDa
Protein Sequence
Protein Sequence
>RC212496 representing NM_005348
Red=Cloning site Green=Tags(s)

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL
DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH
SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI
KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD
LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH
IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK
QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA
KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE
DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005339
RefSeq Size 2912
RefSeq ORF 2196
Synonyms EL52; HEL-S-65p; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; Hsp103; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Locus ID 3320
UniProt ID P07900
Cytogenetics 14q32.31
Summary The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome
Protein Pathways Antigen processing and presentation, NOD-like receptor signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer
Write Your Own Review
You're reviewing:HSP90AA1 (NM_005348) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318420 HSP90AA1 MS Standard C13 and N15-labeled recombinant protein (NP_001017963) 10 ug
$3,255.00
LC400399 HSP90AA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417365 HSP90AA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400399 Transient overexpression lysate of heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1 100 ug
$665.00
LY417365 Transient overexpression lysate of heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 2 100 ug
$665.00
TP312496 Recombinant protein of human heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 2, 20 µg 20 ug
$737.00
TP318420 Recombinant protein of human heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.