ZSCAN4 (NM_152677) Human Mass Spec Standard

SKU
PH311003
ZSCAN4 MS Standard C13 and N15-labeled recombinant protein (NP_689890)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211003]
Predicted MW 49 kDa
Protein Sequence
Protein Sequence
>RC211003 protein sequence
Red=Cloning site Green=Tags(s)

MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH
SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ
EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT
NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ
SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF
QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
ITLPSVPSTPEAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689890
RefSeq Size 2260
RefSeq ORF 1299
Synonyms ZNF494
Locus ID 201516
UniProt ID Q8NAM6
Cytogenetics 19q13.43
Summary The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).[supplied by OMIM, May 2010]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZSCAN4 (NM_152677) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407355 ZSCAN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407355 Transient overexpression lysate of zinc finger and SCAN domain containing 4 (ZSCAN4) 100 ug
$436.00
TP311003 Recombinant protein of human zinc finger and SCAN domain containing 4 (ZSCAN4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.