OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERAS (NM_181532) Human Mass Spec Standard

Be the first to review this product
SKU
PH310965
ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503689 ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6) 100 ul
$447.00
LY405694 Transient overexpression lysate of ES cell expressed Ras (ERAS) (as WB positive control) 100 ug
$436.00

Other products for "ERAS or NM_181532"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210965
Predicted MW 25.3 kDa
Protein Sequence
Protein Sequence
>RC210965 protein sequence
Red=Cloning site Green=Tags(s)

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP
MARSCREKTRHQKATCHCGCSVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_853510
RefSeq Size 826
RefSeq ORF 699
Synonyms HRAS2; HRASP
Locus ID 3266
UniProt ID Q7Z444
Cytogenetics Xp11.23
Summary This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. provided by RefSeq, Dec 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERAS" proteins (3)
SKU Description Size Price
LC405694 Lyophilized ERAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405694 Transient overexpression lysate of ES cell expressed Ras (ERAS) (as WB positive control) 100 ug
$436.00
TP310965 Recombinant protein of human ES cell expressed Ras (ERAS), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products