ERAS (NM_181532) Human Mass Spec Standard

SKU
PH310965
ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210965]
Predicted MW 25.3 kDa
Protein Sequence
Protein Sequence
>RC210965 protein sequence
Red=Cloning site Green=Tags(s)

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP
MARSCREKTRHQKATCHCGCSVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_853510
RefSeq Size 826
RefSeq ORF 699
Synonyms HRAS2; HRASP
Locus ID 3266
UniProt ID Q7Z444
Cytogenetics Xp11.23
Summary This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ERAS (NM_181532) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405694 ERAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405694 Transient overexpression lysate of ES cell expressed Ras (ERAS) 100 ug
$436.00
TP310965 Recombinant protein of human ES cell expressed Ras (ERAS), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.