OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ROMO1 (NM_080748) Human Mass Spec Standard

Be the first to review this product
SKU
PH310655
ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505580 ROMO1 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12) 100 ul
$447.00
LY409065 Transient overexpression lysate of reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "ROMO1 or NM_080748"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210655
Predicted MW 8.2 kDa
Protein Sequence
Protein Sequence
>RC210655 protein sequence
Red=Cloning site Green=Tags(s)

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF
MAIGMGIRC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542786
RefSeq Size 477
RefSeq ORF 237
Synonyms bA353C18.2; C20orf52; MTGM; MTGMP
Locus ID 140823
UniProt ID P60602
Cytogenetics 20q11.22
Summary The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. provided by RefSeq, Nov 2014
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ROMO1" proteins (3)
SKU Description Size Price
LC409065 Lyophilized ROMO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409065 Transient overexpression lysate of reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP310655 Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products